PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009105041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 402aa    MW: 45622.5 Da    PI: 6.2733
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009105041.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.11.8e-081457340
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    +r C+ + +k+++++C  ++ +lC++C ++ H+       H++v
  XP_009105041.1 14 ARACDSCVKKRARWYCAADDAFLCHSCDSSVHSAnplacrHERV 57
                    578*****************************668888888876 PP

2CCT68.51.8e-23353396144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  XP_009105041.1 353 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 396
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.6231259IPR000315B-box-type zinc finger
SMARTSM003367.4E-81259IPR000315B-box-type zinc finger
PfamPF006431.4E-61457IPR000315B-box-type zinc finger
CDDcd000215.88E-91559No hitNo description
PfamPF062035.2E-18353395IPR010402CCT domain
PROSITE profilePS5101716.083353395IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MMKSLANAVG GKTARACDSC VKKRARWYCA ADDAFLCHSC DSSVHSANPL ACRHERVRLK  60
TASAGKHRHA SSSPPHPATW HQGFTRKART PRGGKKSHTM VFHDLVPEMS SEDQRYEVEE  120
QLIFEVPVLN PMGNEQCLKE TKIVFPMMPV CFKSNEEEDD NTESCLNGLF PTEMELAQFS  180
ADVETLLGGG TDREFHAMEE IGFGEMLKIE KEEVKEEEEV ATREVCDLDD ANETSPFEIS  240
FDYESSHKTA FEEDDEKEDV MKNLVDVGVN EVTGRIKEEK KEKVLMLRLD YETVISTWGS  300
QGTPWTALKP SEIDLDMLCC QTNSMCESGG EAHHHNHFPG LGLHMREAGD GGREARVSRY  360
REKRRTRLFS KKIRYEVRKL NAEKRPRMKG RFVKRSSIVA AH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1363379RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.102790.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105041.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1
RefseqXP_009105042.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2
RefseqXP_013649118.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
SwissprotQ8LG760.0COL6_ARATH; Zinc finger protein CONSTANS-LIKE 6
TrEMBLM4CIK10.0M4CIK1_BRARP; Uncharacterized protein
STRINGBra004035.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.10.0B-box type zinc finger protein with CCT domain